PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0498s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family ZF-HD
Protein Properties Length: 101aa    MW: 10793.1 Da    PI: 8.2928
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0498s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.95.9e-343087360
          ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                         +vrY eC+kNhAa++Gg+avDGC+Efm+s+geegt+aal+CaACgCHR+FHRre e+e
  Cagra.0498s0002.1.p 30 TVRYGECQKNHAAAVGGYAVDGCREFMASRGEEGTVAALTCAACGCHRSFHRREIETE 87
                         79****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257746.0E-34197IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.3E-293184IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.0E-283284IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.6423383IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 101 aa     Download sequence    Send to blast
MRKRQVVLRR ASPEEPSRSS STASSLTVRT VRYGECQKNH AAAVGGYAVD GCREFMASRG  60
EEGTVAALTC AACGCHRSFH RREIETEVVC DCNSPPSTGN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_974373.15e-68mini zinc finger 2
RefseqXP_006292529.15e-68hypothetical protein CARUB_v10018759mg
SwissprotQ9LJW57e-70MIF2_ARATH; Mini zinc finger protein 2
TrEMBLR0FRW76e-68R0FRW7_9BRAS; Uncharacterized protein
STRINGAT3G28917.12e-67(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94428114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.19e-49mini zinc finger 2